PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.312940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 306aa    MW: 34188.3 Da    PI: 6.6236
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.312940.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l++ v++ G g+W+  ++  g++R++k+c++rw +yl
   Cucsa.312940.1 14 KGPWTPEEDEKLIEFVAKNGHGSWRNLPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.18.3e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+  +++++ +lG++ W++Ia++++ gRt++++k++w+++l
   Cucsa.312940.1  67 RGKFSEEEETSIIKLHSLLGNR-WSKIASHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129419.997961IPR017930Myb domain
SuperFamilySSF466891.16E-3111108IPR009057Homeodomain-like
SMARTSM007171.3E-151363IPR001005SANT/Myb domain
PfamPF002491.9E-171461IPR001005SANT/Myb domain
CDDcd001673.01E-121661No hitNo description
PROSITE profilePS5129427.47962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2765116IPR009057Homeodomain-like
SMARTSM007172.4E-1766114IPR001005SANT/Myb domain
PfamPF002499.6E-1767112IPR001005SANT/Myb domain
CDDcd001674.82E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGRSPCCDEN GVKKGPWTPE EDEKLIEFVA KNGHGSWRNL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SEEEETSIIK LHSLLGNRWS KIASHLPGRT DNEIKNFWNT HLRKKLLQMG  120
IDPNTHKPRT DLNHFLNLSQ LFNNGIPNPL TSDHLKLQAE IAKLQLLQNL CQLLNPTTAI  180
PTTINSNGFQ NPNPSQFQAG SSTGFASVSG FEDGDKINKA NKLEEMGSFD YVIQPENYYQ  240
LPPLILESPD GSTSNVNQIE SIETNPLCFS TNSNSPTPSS SIFDSLESLM NDDEASGSYW  300
KNILQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29141167108B-MYB
1h8a_C2e-291411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818240.0LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008465998.10.0PREDICTED: transcription factor MYB39
SwissprotQ8GWP01e-82MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0A0LH601e-132A0A0A0LH60_CUCSA; Uncharacterized protein
STRINGVIT_02s0012g01650.t014e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.24e-83myb domain protein 9